VIMSS536082 has 436 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-37 113.8 2.9 5.1e-37 113.4 2.9 1.2 1 VIMSS536082 Domain annotation for each sequence (and alignments): >> VIMSS536082 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.4 2.9 5.1e-37 5.1e-37 2 181 .] 9 185 .. 8 185 .. 0.97 Alignments for each domain: == domain 1 score: 113.4 bits; conditional E-value: 5.1e-37 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilv 99 a++l++l ++f+a+++A++++s +r++el++++++ga +l k+++++ r+++ +++++ ++i +++l+ +++ + ++ ++++ a +i+++ +v VIMSS536082 9 GAVALIALGGLFAAIDAAISTVSLARVQELVRDERPGAVALSKVMSERPRYINLVVLLRITCEITATVLLVVFLYDNFG-LRWGLFGAAAIMVVTSFV 105 679***************************************************************************9.89**************** PP CNNM 100 fGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieeee 181 + + P+tl+++na++ial ++ pl+v+s+ll+P+++ll +l n+++ G + +++p+++e elr++v++++++Gv+ +ee VIMSS536082 106 VMGVGPRTLGRQNAYSIALTTVLPLQVISWLLMPISRLLVVLGNAVT--PGRGLRNGPFASEIELREVVDLAQQRGVVAAEE 185 ***********************************************..44488***********************98886 PP
Or compare VIMSS536082 to CDD or PaperBLAST