PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS536082 to PF01595 (DUF21)

VIMSS536082 has 436 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.1e-35  107.6   2.3    4.3e-35  107.1   2.3    1.2  1  VIMSS536082  


Domain annotation for each sequence (and alignments):
>> VIMSS536082  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  107.1   2.3   4.3e-35   4.3e-35       2     176 .]       9     185 ..       8     185 .. 0.98

  Alignments for each domain:
  == domain 1  score: 107.1 bits;  conditional E-value: 4.3e-35
        DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilv 99 
                   +v+l++l ++f++  +A++++s +r++el+++++++a +l k+++++ r+++ ++++   ++i +++l+ +++++ ++  +++++ a +i+++  +v
  VIMSS536082   9 GAVALIALGGLFAAIDAAISTVSLARVQELVRDERPGAVALSKVMSERPRYINLVVLLRITCEITATVLLVVFLYDNFG-LRWGLFGAAAIMVVTSFV 105
                  5799************************************************************************999.79**************** PP

        DUF21 100 fgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil...esesepavseeelkklveeseeegvieeee 176
                  +  + P++l++++a +ial ++ pl+v+++ll+P+++ll  l n+++   + +++p+ se el+++v++++++gv+ +ee
  VIMSS536082 106 VMGVGPRTLGRQNAYSIALTTVLPLQVISWLLMPISRLLVVLGNAVTpgrGLRNGPFASEIELREVVDLAQQRGVVAAEE 185
                  **************************************************99***********************98887 PP



Or compare VIMSS536082 to CDD or PaperBLAST