VIMSS5420990 has 428 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-44 135.5 4.5 1.1e-43 135.0 4.5 1.2 1 VIMSS5420990 Domain annotation for each sequence (and alignments): >> VIMSS5420990 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.0 4.5 1.1e-43 1.1e-43 4 181 .] 1 176 [. 1 176 [. 0.98 Alignments for each domain: == domain 1 score: 135.0 bits; conditional E-value: 1.1e-43 CNNM 4 llllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvf 100 ++l++++a+f+a+E+Alvs s++ ++ +kg k+a +++k +e+p+++Ls ++i++ + ++l + ++ + f+++ ++++i+ +i+ ++ ++f VIMSS5420990 1 MILIIFNAIFAASEIALVSSSENAIDLDIKKGFKKAIKVKKNKEKPTNFLSMIQIMIHILTFLQGNVVMKYFSDFK---GFQLYIIEIIIIFVSIIF 94 589**********************************************************************985...699*************** PP CNNM 101 GEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGv.kkeeepavteeelrslveeseeeGvieeee 181 GE++Pk+la++ ++k+ +++ +++++s+l++Plvwll+++ n+il +lG+ ++ + ++e+e+r l+++s+++G+i+++e VIMSS5420990 95 GELIPKRLAMNSPLKTTYIFVNLMNFISFLFTPLVWLLTKINNFILIILGFdPNKIVNSFSEDEIRLLLSSSYRKGIIDRNE 176 ******************************************************************************9976 PP
Or compare VIMSS5420990 to CDD or PaperBLAST