PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5420990 to PF01595 (DUF21)

VIMSS5420990 has 428 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.3e-40  125.1   4.6    1.8e-40  124.6   4.6    1.2  1  VIMSS5420990  


Domain annotation for each sequence (and alignments):
>> VIMSS5420990  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  124.6   4.6   1.8e-40   1.8e-40       4     176 .]       1     176 [.       1     176 [. 0.97

  Alignments for each domain:
  == domain 1  score: 124.6 bits;  conditional E-value: 1.8e-40
         DUF21   4 vlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvf 100
                   ++l++++a+f+++E+Alvs s++ ++   +kg kka +++k  ++p ++Ls ++i++ + ++l + ++ + f+++    +++++i+ +i+ ++ ++f
  VIMSS5420990   1 MILIIFNAIFAASEIALVSSSENAIDLDIKKGFKKAIKVKKNKEKPTNFLSMIQIMIHILTFLQGNVVMKYFSDFK---GFQLYIIEIIIIFVSIIF 94 
                   5899*******************************************************************99974...699*************** PP

         DUF21 101 gEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseeegvieeee 176
                   gE++Pk+la++ ++k+  +++ ++ ++++l++Plvwll+k+ n+il       ++  + +se+e++ l+++s+++g+i++ e
  VIMSS5420990  95 GELIPKRLAMNSPLKTTYIFVNLMNFISFLFTPLVWLLTKINNFILiilgfdPNKIVNSFSEDEIRLLLSSSYRKGIIDRNE 176
                   ***************************************************999999*********************9876 PP



Or compare VIMSS5420990 to CDD or PaperBLAST