PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS548707 to PF01595 (DUF21)

VIMSS548707 has 400 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.8e-47  145.8   0.9    8.2e-47  145.3   0.9    1.2  1  VIMSS548707  


Domain annotation for each sequence (and alignments):
>> VIMSS548707  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  145.3   0.9   8.2e-47   8.2e-47      21     169 ..       1     154 [.       1     161 [. 0.97

  Alignments for each domain:
  == domain 1  score: 145.3 bits;  conditional E-value: 8.2e-47
        DUF21  21 vslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEilPkslalkyaekial 118
                  ++++r rl++la++g+ +a+r++ ll++pe+l+s +lign+lvnil+salat + ++l+  g+++v+iat i+t+++l+f+E++Pk++a+ y+ek+a+
  VIMSS548707   1 MTMNRYRLRHLAKQGNHSARRVEALLRHPEQLISLILIGNNLVNILASALATIIGMRLY--GDAGVAIATGILTFIVLIFSEVMPKTIAALYPEKVAF 96 
                  789********************************************************..69*********************************** PP

        DUF21 119 alapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklveeseee 169
                   ++ +lr l++++ Plvw+l+k++ l++        + s++a+s++el+++v es+++
  VIMSS548707  97 PSSFLLRPLQKIMLPLVWVLNKITLLLMrclgikqPTGSSHAMSKDELRTIVHESNAK 154
                  ************************9999******9999****************9987 PP



Or compare VIMSS548707 to CDD or PaperBLAST