PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5917390 to PF01595 (DUF21)

VIMSS5917390 has 440 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    7.2e-35  106.4   2.5      1e-34  105.9   2.5    1.2  1  VIMSS5917390  


Domain annotation for each sequence (and alignments):
>> VIMSS5917390  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  105.9   2.5     1e-34     1e-34       1     176 []      10     188 ..      10     188 .. 0.98

  Alignments for each domain:
  == domain 1  score: 105.9 bits;  conditional E-value: 1e-34
         DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtlli 97 
                   +++v+ ll+s+++ ++E Al+s+sr+r+e++ +++ ++++ ll++++++   ++ l+++ tl    ++++a+a++v+++   a+++v+a+v+v+ll+
  VIMSS5917390  10 IATVVALLFSGLLGAVESALSSVSRARVEQMLKDEASGSASLLRVIDERALHINMLIMLRTLLDASAAVFAGAIAVNVMDSWAWGIVLAIVVVSLLT 106
                   57889999***********************************************************************999999************ PP

         DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil...esesepavseeelkklveeseeegvieeee 176
                   + +  ++ +++++k++ ++ l++a++l+ l ++l P+++ l ++ n+i    + +++p+ +e el+++v++++e+g++e ee
  VIMSS5917390 107 FAVVGVFGRTVGRKNPYSVMLRSAVVLSGLAKILGPIARGLIWIGNIIApgpGFRNGPYATEVELREMVDIAQEHGIVEIEE 188
                   ****************************************************99**********************998776 PP



Or compare VIMSS5917390 to CDD or PaperBLAST