PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS60197 to PF01595 (DUF21)

VIMSS60197 has 430 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-41  128.2   0.2    2.1e-41  127.7   0.2    1.2  1  VIMSS60197  


Domain annotation for each sequence (and alignments):
>> VIMSS60197  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  127.7   0.2   2.1e-41   2.1e-41       2     149 ..      12     165 ..      11     189 .. 0.92

  Alignments for each domain:
  == domain 1  score: 127.7 bits;  conditional E-value: 2.1e-41
       DUF21   2 iivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvf 100
                 ++vll+++saffs++EtAl++l+r rl+ +a++g ++a+r  +ll + +rl  tll+g tlvn+ ++ala++++ + +  g +++++a+  +tll+l+f
  VIMSS60197  12 LLVLLVACSAFFSCVETALLNLDRYRLRLQAKQGLRGARRSSWLLLHDDRLRGTLLFGRTLVNVSAAALASWAALRHW--GVIGLAVAIPGMTLLLLLF 108
                 569999**********************************************************************99..69***************** PP

       DUF21 101 gEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.........ese 149
                 g +lP+++++ ++e++al l+ pl +l++l++Pl+wll++l+n++l         + +
  VIMSS60197 109 GALLPRRYGALRSERVALPLSLPLLILQRLCWPLLWLLTLLSNALLrllgvaaaeQ-D 165
                 **********************************************9999887642.2 PP



Or compare VIMSS60197 to CDD or PaperBLAST