VIMSS6470 has 403 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-55 173.7 3.5 2.2e-55 173.2 3.5 1.2 1 VIMSS6470 Domain annotation for each sequence (and alignments): >> VIMSS6470 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 173.2 3.5 2.2e-55 2.2e-55 9 173 .. 2 165 .. 1 171 [. 0.98 Alignments for each domain: == domain 1 score: 173.2 bits; conditional E-value: 2.2e-55 CNNM 9 lsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtllilvfGEilPktl 108 lsa fs++Et+l+sl+k+rl+ l+e+gnkgak+++klle+p++lLs +li n+lvni++sa+at++ ++l+ g+++v+iat+++t+++lvf+Ei+Pkt+ VIMSS6470 2 LSAYFSGSETGLLSLNKYRLRFLSEQGNKGAKKAEKLLEKPDTLLSFILIFNNLVNISASAIATVIGMRLY--GDAGVAIATGLLTFVMLVFSEIFPKTV 99 8**********************************************************************..79************************* PP CNNM 109 alknaekialavapplrvlsillyPlvwllnllanlilrllGv.kkeeepavteeelrslveesee 173 a+ +aek++++++++l l +++yPlvwl+n +++ +++++G + +++++++eelrs+v+e+ e VIMSS6470 100 AAMHAEKVSFFSSHILTSLLKIFYPLVWLMNIFTKSLMQIVGLkLDMQKQVISSEELRSIVSEAGE 165 **************************************************************9977 PP
Or compare VIMSS6470 to CDD or PaperBLAST