PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS6470 to PF01595 (DUF21)

VIMSS6470 has 403 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    7.2e-51  158.5   3.2      1e-50  158.0   3.2    1.2  1  VIMSS6470  


Domain annotation for each sequence (and alignments):
>> VIMSS6470  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  158.0   3.2     1e-50     1e-50       9     169 ..       2     166 ..       1     171 [. 0.97

  Alignments for each domain:
  == domain 1  score: 158.0 bits;  conditional E-value: 1e-50
      DUF21   9 lsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEilPksl 108
                lsa+fsg+Et+l+sl++ rl+ l+e+g+k+ak+++kll++p+ lLs +li n+lvni +sa+at++ ++l+  g+++v+iat ++t+++lvf+Ei+Pk++
  VIMSS6470   2 LSAYFSGSETGLLSLNKYRLRFLSEQGNKGAKKAEKLLEKPDTLLSFILIFNNLVNISASAIATVIGMRLY--GDAGVAIATGLLTFVMLVFSEIFPKTV 99 
                8**********************************************************************..69************************* PP

      DUF21 109 alkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseee 169
                a+ +aek++++++ +l  l++++yPlvwl++ +++ ++       + +++++s+eel+++v+e+ e+
  VIMSS6470 100 AAMHAEKVSFFSSHILTSLLKIFYPLVWLMNIFTKSLMqivglkLDMQKQVISSEELRSIVSEAGEA 166
                ********************************************999***************99775 PP



Or compare VIMSS6470 to CDD or PaperBLAST