PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS675760 to PF01595 (DUF21)

VIMSS675760 has 396 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-45  140.9   1.4    2.7e-45  140.4   1.4    1.2  1  VIMSS675760  


Domain annotation for each sequence (and alignments):
>> VIMSS675760  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  140.4   1.4   2.7e-45   2.7e-45      20     166 ..       1     152 [.       1     157 [. 0.98

  Alignments for each domain:
  == domain 1  score: 140.4 bits;  conditional E-value: 2.7e-45
        DUF21  20 lvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtllilvfgEilPkslalkyaekia 117
                  ++sl+r rl++la +g+k+akr++kll++p+rl+  +lign+lvnil+sa+at l ++l+  g+l+v+iat ++tl++lvf+E++Pk++a+ y+e+++
  VIMSS675760   1 MMSLNRYRLKHLANSGHKGAKRVEKLLSRPDRLIGLILIGNNLVNILASAIATILGMRLY--GDLGVAIATGALTLVVLVFAEVTPKTVAALYPERVS 96 
                  79**********************************************************..69********************************** PP

        DUF21 118 lalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklvees 166
                   a++ +l vlm+ll+Plv+l++ ++n+++       +++ e+ +s+eel+++v+e+
  VIMSS675760  97 YASSILLVVLMKLLSPLVMLVNFITNGFIrllglkaQHNGEDNLSSEELRTVVNEA 152
                  ************************************999**************987 PP



Or compare VIMSS675760 to CDD or PaperBLAST