VIMSS677648 has 450 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-49 152.9 2.9 5.4e-49 152.4 2.9 1.2 1 VIMSS677648 Domain annotation for each sequence (and alignments): >> VIMSS677648 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 152.4 2.9 5.4e-49 5.4e-49 2 180 .. 22 211 .. 21 212 .. 0.98 Alignments for each domain: == domain 1 score: 152.4 bits; conditional E-value: 5.4e-49 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellae...........galavvi 88 i+++l+l s ffs++E+Al +++k+rl++l+++g+++a ++l+l +np ++ ++++ig + v i+ +++++++f+ +++ ++++++ VIMSS677648 22 IIFALILSSCFFSMSEIALAAARKIRLKQLSDEGDERATKVLELQANPGNFFTVVQIGLNAVAIMGGIVGESAFTPYIKAaldgivpaawlAQVSFFL 119 6799**************************************************************************99***********99***** PP CNNM 89 atvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieee 180 ++++vt ++++f++++Pk++a++ +ekia+ +++p+ v++++l+P+++++n lanli++ll + +e+++ +t++++ +++++++e Gv+++ VIMSS677648 120 SFFLVTSMFILFADLMPKRIAMAVPEKIAISLVGPMLVCITILKPFIFIFNGLANLIFQLLSIPAERNDDITSDDIYAVMDAGAEAGVLDRG 211 *****************************************************************************************986 PP
Or compare VIMSS677648 to CDD or PaperBLAST