PaperBLAST – Find papers about a protein or its homologs

 

Align WP_005462557.1 to PF01595 (DUF21)

WP_005462557.1 has 426 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-53  167.4   1.5    1.9e-53  166.9   1.5    1.1  1  WP_005462557.1  


Domain annotation for each sequence (and alignments):
>> WP_005462557.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  166.9   1.5   1.9e-53   1.9e-53       3     166 ..      13     181 ..      10     187 .. 0.96

  Alignments for each domain:
  == domain 1  score: 166.9 bits;  conditional E-value: 1.9e-53
           DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtlli 97 
                     +  l+++s++fsg+Et+++sl+r rl++la++g+k+akr++kll++p+rl+  +lign+lvnil+sa+at + ++l+  g+l+v+iat ++t+++
  WP_005462557.1  13 LACLIVISGYFSGSETGMMSLNRYRLKHLAKSGHKGAKRVEKLLDRPDRLIGLILIGNNLVNILASAIATIIGMRLY--GDLGVAIATGALTMVV 105
                     345669***********************************************************************..69************** PP

           DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklvees 166
                     lvf+E++Pk++a+ y+e+++ a++ +l +lm++l+Plv+l++ ++n+++        +  e+ +s+eel+++v+e+
  WP_005462557.1 106 LVFAEVTPKTVAALYPERVSYASSILLTILMKVLSPLVMLVNFITNGFIrllgvkaDHTVEDHLSSEELRTVVNEA 181
                     ******************************************************99889999***********986 PP



Or compare WP_005462557.1 to CDD or PaperBLAST