PaperBLAST – Find papers about a protein or its homologs

 

Align WP_011079538.1 to PF01595 (DUF21)

WP_011079538.1 has 425 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.6e-53  167.1   2.7    2.4e-53  166.6   2.7    1.2  1  WP_011079538.1  


Domain annotation for each sequence (and alignments):
>> WP_011079538.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  166.6   2.7   2.4e-53   2.4e-53       3     166 ..      13     181 ..      10     186 .. 0.96

  Alignments for each domain:
  == domain 1  score: 166.6 bits;  conditional E-value: 2.4e-53
           DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtlli 97 
                     +  l+++s++fsg+Et+++sl+r rl++la +g+k+akr++kll++p+rl+  +lign+lvnil+sa+at l ++l+  g+l+v+iat ++tl++
  WP_011079538.1  13 LACLIVISGYFSGSETGMMSLNRYRLKHLANSGHKGAKRVEKLLSRPDRLIGLILIGNNLVNILASAIATILGMRLY--GDLGVAIATGALTLVV 105
                     345669***********************************************************************..69************** PP

           DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklvees 166
                     lvf+E++Pk++a+ y+e+++ a++ +l vlm+ll+Plv+l++ ++n+++       +++ e+ +s+eel+++v+e+
  WP_011079538.1 106 LVFAEVTPKTVAALYPERVSYASSILLVVLMKLLSPLVMLVNFITNGFIrllglkaQHNGEDNLSSEELRTVVNEA 181
                     ********************************************************999**************987 PP



Or compare WP_011079538.1 to CDD or PaperBLAST