PaperBLAST – Find papers about a protein or its homologs

 

Align WP_014342235.1 to PF01595 (DUF21)

WP_014342235.1 has 457 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-38  118.7   5.1    1.8e-38  118.2   5.1    1.2  1  WP_014342235.1  


Domain annotation for each sequence (and alignments):
>> WP_014342235.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  118.2   5.1   1.8e-38   1.8e-38       3     175 ..      46     222 ..      44     223 .. 0.94

  Alignments for each domain:
  == domain 1  score: 118.2 bits;  conditional E-value: 1.8e-38
           DUF21   3 ivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvivtlli 97 
                     +v+ll+ls +fs+aEtA+ +l++lrl+ l ek++++a+ ++++l++ +++L++++igntl++ +lsa++++++  l++    av +++ + t+l+
  WP_014342235.1  46 LVVLLVLSMLFSAAETAFCALNTLRLRYLYEKRHARARVAMRILRRKNFYLAAVVIGNTLASSALSAVIALFARALFGI--HAVGWSIGAGTVLT 138
                     68999************************************************************************75..5999999999**** PP

           DUF21  98 lvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil......esesepavseeelkklveeseeegvieee 175
                     l+fgEi+Pkslal ++ ++al +a++l++    l+P+v ++ +   ++l       +  +  v++++l +++ ++e+ g++ ++
  WP_014342235.1 139 LLFGEIIPKSLALCRPNAVALHTARFLQWSALMLTPFVQVFCMARSALLrlarvaCHTPSLRVTDDDLHTVLYAGEADGTVTSR 222
                     **************************************998888888888899997788999*************999998655 PP



Or compare WP_014342235.1 to CDD or PaperBLAST