WP_017411603.1 has 426 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-58 183.7 5.5 1.9e-58 183.2 5.5 1.1 1 WP_017411603.1 Domain annotation for each sequence (and alignments): >> WP_017411603.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 183.2 5.5 1.9e-58 1.9e-58 1 171 [. 11 179 .. 11 183 .. 0.98 Alignments for each domain: == domain 1 score: 183.2 bits; conditional E-value: 1.9e-58 CNNM 1 liallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtl 95 +++++l+llsaffs++Et+l+s+++++l++la++++k a+r+++ll++p+rlL +lign+lvni++sa+at + ++l+ g+l+v+iat+ +tl WP_017411603.1 11 IVLVILILLSAFFSSSETGLMSINRYKLRHLAQTKHKAARRVEQLLARPDRLLGLILIGNNLVNIFASAIATIVCIRLF--GDLGVAIATFGLTL 103 5789***************************************************************************..89************ PP CNNM 96 lilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslvees 171 ++lvfGE++Pktla+ +e++a +++l+ l++ lyP+vwl+n ++ ++l+ll+v ++++a+ eelr++v+e+ WP_017411603.1 104 VVLVFGEVTPKTLAAMFPERVAYPASWILKGLMVPLYPFVWLINGITSGLLKLLRVTPNKNDALNTEELRTIVNEA 179 *************************************************************************997 PP
Or compare WP_017411603.1 to CDD or PaperBLAST