WP_025889658.1 has 443 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.7e-49 152.9 3.0 5.4e-49 152.4 3.0 1.2 1 WP_025889658.1 Domain annotation for each sequence (and alignments): >> WP_025889658.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 152.4 3.0 5.4e-49 5.4e-49 2 181 .] 9 199 .. 7 199 .. 0.97 Alignments for each domain: == domain 1 score: 152.4 bits; conditional E-value: 5.4e-49 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellae...........gala 85 i++ l+ s ffs++E+Al + +k+rl+++ae+g+ +a+++l l p + ++++ig + v i+ +++++++f+ ++a g+l+ WP_025889658.1 9 IIFCLIGTSCFFSMSEIALAASRKIRLRQMAEEGDLRAEKVLALQTTPGSFFTVVQIGLNAVAIMGGIVGESAFTPYFAAalahvipqawvGQLS 103 556666************************************************************************99*************** PP CNNM 86 vviatvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieee 180 +v+++v+vt l++++++++Pk++a++ +ek+a+ ++ p+ ++++ll+P+vw++n +an+i++ll + +++++++t++++ +++++++e Gv+++ WP_025889658.1 104 FVLSFVLVTSLFILIADLMPKRVAMALPEKVAVNLVNPMLICITLLRPFVWIFNGMANGIFKLLQIPTARNDEITPDDIYAIMDAGAEAGVLDKG 198 ********************************************************************************************986 PP CNNM 181 e 181 e WP_025889658.1 199 E 199 5 PP
Or compare WP_025889658.1 to CDD or PaperBLAST