WP_081078434.1 has 427 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-53 167.8 3.6 1.6e-53 167.1 3.6 1.2 1 WP_081078434.1 Domain annotation for each sequence (and alignments): >> WP_081078434.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 167.1 3.6 1.6e-53 1.6e-53 2 179 .. 5 194 .. 4 196 .. 0.97 Alignments for each domain: == domain 1 score: 167.1 bits; conditional E-value: 1.6e-53 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellae............gal 84 i++ll+ll+++fs++E+Al+s++k+rle+ a+kgn +ak++l l + p+++Lst++ig+tl+ il++++ + +++ ++ ++l WP_081078434.1 5 IIFLLILLNGVFSMSEIALISARKNRLETAAKKGNTSAKTALDLANSPNKFLSTVQIGITLIGILTGIYSGDKITHDVQAffasypvtvpysKSL 99 789999**************************************************************9999999988889999********99* PP CNNM 85 avviatvivtllilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGviee 179 + +++v +t++ lv+GE+lPk+++l+++e+ia ava+p++++s+ ++P++wll+ ++++il++l +k + vteee++++++e++e G+++e WP_081078434.1 100 GTGVVVVMLTFFSLVLGELLPKRIGLNYPETIAKAVAVPMKMISVATAPFIWLLTSSTEFILKVLNIKPTADGKVTEEEIKAIIKEGTEGGEVQE 194 *******************************************************************************************9987 PP
Or compare WP_081078434.1 to CDD or PaperBLAST