WP_128789995.1 has 428 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-35 108.2 2.6 2.8e-35 107.7 2.6 1.2 1 WP_128789995.1 Domain annotation for each sequence (and alignments): >> WP_128789995.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.7 2.6 2.8e-35 2.8e-35 2 181 .] 8 185 .. 7 185 .. 0.97 Alignments for each domain: == domain 1 score: 107.7 bits; conditional E-value: 2.8e-35 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtll 96 a++l++++ + ++aE++l ++s++r ee +++g++g ++l ++ ++p+r+L++ l+ + ++++++al+t + e+++ ++ a+++a+++++l+ WP_128789995.1 8 GAIALVVVAWLAACAEAGLARVSSFRAEEAVKSGRRGGEKLAQIAADPTRYLNVALLVRVACEMAAAALVTYACLEAFSATWQALLVAIAVMVLV 102 67999**************************************************************************9*************** PP CNNM 97 ilvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGvkkeeepavteeelrslveeseeeGvieeee 181 v + P+t+++++++ +a + a++l l +++ P+ ll l+ n+++ G + +++p+++e elr+lv+++e+e ie ee WP_128789995.1 103 SYVAVGVSPRTIGRQHPLNTATVAAYVLVPLARVMGPIPSLLILIGNALT--PGKGFRRGPFASEAELRALVDLAEKESLIEDEE 185 **************************************************..45599*********************9998886 PP
Or compare WP_128789995.1 to CDD or PaperBLAST