WP_235214062.1 has 472 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-48 148.6 1.1 1.1e-47 148.1 1.1 1.2 1 WP_235214062.1 Domain annotation for each sequence (and alignments): >> WP_235214062.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 148.1 1.1 1.1e-47 1.1e-47 3 181 .] 30 204 .. 28 204 .. 0.97 Alignments for each domain: == domain 1 score: 148.1 bits; conditional E-value: 1.1e-47 CNNM 3 allllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtlli 97 +++ll++sa+++++E Al+s+++ + ++l++++++ ++rl +ll+++e+l++t+++ nt n++ls+++t +el+ ga +v+ a+v+vt++i WP_235214062.1 30 LMFLLVCSALCAGSESALSSVNQDDERKLKRHSTRCTQRLCWLLARREQLITTVIVQNTALNMVLSSVVTLGSMELW--GAQSVWKALVAVTCVI 122 589**************************************************************************..799************* PP CNNM 98 lvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGv.kkeeepavteeelrslveeseeeGvieeee 181 +++GE++Pk+l++++++ + +++ap+l++ ++llyP++++ ++l ++ G+ ++++ +++ee+++l++++++eGvi+++e WP_235214062.1 123 ILCGEMFPKALGARYSLGFLMWIAPFLQLSYWLLYPCACVSSALMHVLE---GIfLPRHTTCLSREEIKTLIAVGAREGVISSTE 204 ****************************************999988888...7889*************************9876 PP
Or compare WP_235214062.1 to CDD or PaperBLAST