PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002797334.2 to PF01595 (DUF21)

XP_002797334.2 has 745 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.3e-36  109.5   0.0    1.3e-35  108.8   0.0    1.3  1  XP_002797334.2  


Domain annotation for each sequence (and alignments):
>> XP_002797334.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  108.8   0.0   1.3e-35   1.3e-35       3     171 ..      66     231 ..      64     236 .. 0.90

  Alignments for each domain:
  == domain 1  score: 108.8 bits;  conditional E-value: 1.3e-35
           DUF21   3 ivlllllsaffsgaEtAlvslsrlrl....eelaekgk....kkakrllkllknp.erlLstlligntlvnillsalatalfvellaegalavvi 88 
                     + +l++  + f+g+++Al+  +++ l         +g+    k+a+++l+llk+  +++L+tll+ n ++n  l+++++  ++  +         
  XP_002797334.2  66 AAALVITGGAFAGLTIALMGQDEVYLqvikT----SGEgaekKHAEKVLSLLKRGkHWVLVTLLLSNVITNETLPIVLDRSLGGGWP-------- 148
                     56788999******************55553....444444489999***999998***********************99888774........ PP

           DUF21  89 atvivtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegv 171
                     a++  t li+vfgE++P+s++++y ++i +++ap + vlm++++P++w++ kll+++l++++++ ++++ lk+lv+++++ g 
  XP_002797334.2 149 AVLGSTALIVVFGEVVPQSICVRYGLPIGAWMAPCVLVLMYIMSPVAWPIAKLLDKLLGEDHGTIYKKAGLKTLVTLHKSMGQ 231
                     45555*************************************************************************98875 PP



Or compare XP_002797334.2 to CDD or PaperBLAST