PaperBLAST – Find papers about a protein or its homologs

 

Align XP_002907213.1 to PF01595 (DUF21)

XP_002907213.1 has 425 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.8e-17   49.1   9.9    8.7e-16   44.3   7.4    2.6  2  XP_002907213.1  


Domain annotation for each sequence (and alignments):
>> XP_002907213.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   44.3   7.4   8.7e-16   8.7e-16       3      93 ..      52     151 ..      50     156 .. 0.81
   2 !    7.6   0.3   0.00016   0.00016     118     159 ..     141     182 ..     137     218 .. 0.80

  Alignments for each domain:
  == domain 1  score: 44.3 bits;  conditional E-value: 8.7e-16
           DUF21   3 ivlllllsaffsgaEtAlvslsrlrl............eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegala 85 
                     +v+ll+lsa+f+g+ ++l+sl+ + l             e  + ++++ak++ +l++n + lL+tll+gn  vn+l+s+++++l + + +  ++ 
  XP_002907213.1  52 LVVLLALSAMFAGLGLGLMSLDLIGLeivvaagedehaTETERINSEAAKKVIPLRRNGNLLLTTLLLGNVSVNVLTSIITADLTSVIGG--KV- 143
                     6999*****************************997774444444589************************************766654..33. PP

           DUF21  86 vviatviv 93 
                     v+++ +++
  XP_002907213.1 144 VPLVRILI 151
                     33333333 PP

  == domain 2  score: 7.6 bits;  conditional E-value: 0.00016
           DUF21 118 lalapplrvlmvllyPlvwllskllnlilesesepavseeel 159
                      +++p++r+l+ l+y +++++s+ l + l+++ ++++++ + 
  XP_002907213.1 141 GKVVPLVRILIALFYIFAKPVSLALGATLGEDIGTVFTRRQV 182
                     5799*************************7777777776554 PP



Or compare XP_002907213.1 to CDD or PaperBLAST