PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006527552.1 to PF01595 (DUF21)

XP_006527552.1 has 637 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      5e-41  126.5   0.1    7.9e-41  125.8   0.1    1.2  1  XP_006527552.1  


Domain annotation for each sequence (and alignments):
>> XP_006527552.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  125.8   0.1   7.9e-41   7.9e-41       2     176 .]     261     431 ..     260     431 .. 0.92

  Alignments for each domain:
  == domain 1  score: 125.8 bits;  conditional E-value: 7.9e-41
           DUF21   2 iivlllllsaffsgaEtAlvslsrlrl....eelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavviatvi 92 
                     +i lll+ls++fsg++++l++l++++l    +   ek+k +akr+++++++ + lL++ll+gn lvn+ l++l+++++++ l        +a+v+
  XP_006527552.1 261 FISLLLCLSGMFSGLNLGLMALDPMELrivqNCGTEKEKNYAKRIEPVRRQGNYLLCSLLLGNVLVNTTLTILLDDIAGSGL--------VAVVV 347
                     567899*********************8887566667778*************************************99977........45555 PP

           DUF21  93 vtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlilesesepavseeelkklveeseeegvieeee 176
                      t+ i++fgEi+P++++ ++ +++ + ++ +++++m+ ++P+++++skll+++l++e ++++++e l +++++++  +++ +ee
  XP_006527552.1 348 STIGIVIFGEIVPQAICSRHGLAVGANTIFLTKFFMMMTFPASYPVSKLLDCVLGQEIGTVYNREKLLEMLRVTDPYNDLVKEE 431
                     5***********************************************************************998887776665 PP



Or compare XP_006527552.1 to CDD or PaperBLAST