biolip::7cffA has 156 amino acids
Query: CNNM [M=181] Accession: PF01595.24 Description: Cyclin M transmembrane N-terminal domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-49 152.1 8.1 7.7e-49 151.9 8.1 1.0 1 biolip::7cffA Domain annotation for each sequence (and alignments): >> biolip::7cffA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 151.9 8.1 7.7e-49 7.7e-49 2 151 .. 8 152 .. 7 156 .] 0.95 Alignments for each domain: == domain 1 score: 151.9 bits; conditional E-value: 7.7e-49 CNNM 2 iallllllsaffsaaEtAlvslsklrleelaekgnkgakrllkllenperlLstlligntlvnillsalatalfaellaegalavviatvivtlli 97 +++lll+lsaffsa+EtA+++l + +l+elae++n + l e+ +r+L+t+l+gn+lvni+++alat+l+++++ g+++v +at+++t+li biolip::7cffA 8 VLVLLLALSAFFSASETAITTLYPWKLKELAESKN---GPFRLLAEDITRFLTTILVGNNLVNIAATALATELATQAF--GSAGVGVATGAMTFLI 98 579999***************************97...4456699*********************************..89************** PP CNNM 98 lvfGEilPktlalknaekialavapplrvlsillyPlvwllnllanlilrllGv 151 l+fGEi+Pk+la+++ae+ia + a+p++ ls+l+yP+ ++++l++ ++lrllG biolip::7cffA 99 LFFGEITPKSLAVHHAEAIARLAAWPIYGLSVLFYPVGRFFSLVSGGLLRLLGL 152 *****************************************************8 PP
Or compare biolip::7cffA to CDD or PaperBLAST