PaperBLAST – Find papers about a protein or its homologs

 

Align ecocyc::G7356-MONOMER to PF01595 (DUF21)

ecocyc::G7356-MONOMER has 428 amino acids

Query:       DUF21  [M=176]
Accession:   PF01595.20
Description: Cyclin M transmembrane N-terminal domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence              Description
    ------- ------ -----    ------- ------ -----   ---- --  --------              -----------
    2.3e-54  169.9   2.9    3.4e-54  169.3   2.9    1.2  1  ecocyc::G7356-MONOMER  


Domain annotation for each sequence (and alignments):
>> ecocyc::G7356-MONOMER  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  169.3   2.9   3.4e-54   3.4e-54       1     169 [.      11     184 ..      10     191 .. 0.95

  Alignments for each domain:
  == domain 1  score: 169.3 bits;  conditional E-value: 3.4e-54
                  DUF21   1 liivlllllsaffsgaEtAlvslsrlrleelaekgkkkakrllkllknperlLstlligntlvnillsalatalfvellaegalavvi 88 
                            +i+++++++sa+fsg+Et++++l+r rl+++a++g+++akr++kll++p+rl+s +lign+lvnil+sal+t + ++l+  g+++v+i
  ecocyc::G7356-MONOMER  11 IILIIMVVISAYFSGSETGMMTLNRYRLRHMAKQGNRSAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLY--GDAGVAI 96 
                            4667777************************************************************************..69***** PP

                  DUF21  89 atvivtllilvfgEilPkslalkyaekialalapplrvlmvllyPlvwllskllnlil.......esesepavseeelkklveeseee 169
                            at ++t+++lvf+E+lPk++a+ y+ek+a  ++ +l  l++l++Plvwll+++++ ++           +  +s+eel+++v es+++
  ecocyc::G7356-MONOMER  97 ATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQILMMPLVWLLNAITRMLMrmmgiktDIVVSGSLSKEELRTIVHESRSQ 184
                            *************************************************************998766678899************987 PP



Or compare ecocyc::G7356-MONOMER to CDD or PaperBLAST