PaperBLAST – Find papers about a protein or its homologs

 

Align NP_006618.1 to PF01868 (UPF0086)

NP_006618.1 has 220 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.6e-31   92.4   0.0    9.7e-31   91.9   0.0    1.2  1  NP_006618.1  


Domain annotation for each sequence (and alignments):
>> NP_006618.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   91.9   0.0   9.7e-31   9.7e-31       1      84 []     128     210 ..     128     210 .. 0.97

  Alignments for each domain:
  == domain 1  score: 91.9 bits;  conditional E-value: 9.7e-31
                  HHHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
      UPF0086   1 ekLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84 
                  +kLlkadlhGa ++V++sk+ps+vgi+Gi ++Etk+++ki+tk++r+k++pK ++vF++e  d +   ++Gs+++ r+++R+ +
  NP_006618.1 128 AKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVET-DGFISYIYGSKFQLRSSERSAK 210
                  59***********************************************************.79999**************875 PP



Or compare NP_006618.1 to CDD or PaperBLAST