PaperBLAST – Find papers about a protein or its homologs

 

Align NP_648168.1 to PF01868 (UPF0086)

NP_648168.1 has 206 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.6e-29   88.0   0.1    2.6e-29   87.3   0.1    1.3  1  NP_648168.1  


Domain annotation for each sequence (and alignments):
>> NP_648168.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   87.3   0.1   2.6e-29   2.6e-29       2      83 ..     115     195 ..     114     196 .. 0.98

  Alignments for each domain:
  == domain 1  score: 87.3 bits;  conditional E-value: 2.6e-29
                  HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHC CS
      UPF0086   2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRae 83 
                  kL+k dlhGa+++V++sk+++l +++Gi+v++tkn+lk+  k++r++t+pK+++vF ++v +++e+++ G++l++rpa+R+ 
  NP_648168.1 115 KLVKLDLHGAKMKVLQSKCSTLENLAGICVMDTKNVLKLLGKDHRLRTIPKSECVFGMKV-GNMEFTIFGQHLNIRPAERSV 195
                  8***********************************************************.8******************86 PP



Or compare NP_648168.1 to CDD or PaperBLAST