O95707 has 220 amino acids
Query: RNase_P-MRP_p29 [M=84]
Accession: PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2e-32 97.3 0.1 3e-32 96.7 0.1 1.2 1 O95707
Domain annotation for each sequence (and alignments):
>> O95707
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 96.7 0.1 3e-32 3e-32 1 84 [] 128 210 .. 128 210 .. 0.95
Alignments for each domain:
== domain 1 score: 96.7 bits; conditional E-value: 3e-32
RNase_P-MRP_p29 1 akllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84
akllkadlhGa ++V++sk+ps+vGi+Gi ++Etk+ +ki+tke+++k+ipK ++vF++e + i+Gs+++lr+++R+ k
O95707 128 AKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGF-ISYIYGSKFQLRSSERSAK 210
59***********************************************************444.799*************976 PP
Or compare O95707 to CDD or PaperBLAST