PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q57903 to PF01868 (UPF0086)

SwissProt::Q57903 has 95 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.3e-29   88.3   0.9    1.5e-29   88.1   0.9    1.0  1  SwissProt::Q57903  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q57903  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   88.1   0.9   1.5e-29   1.5e-29       2      84 .]       6      87 ..       5      87 .. 0.97

  Alignments for each domain:
  == domain 1  score: 88.1 bits;  conditional E-value: 1.5e-29
                       HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
            UPF0086  2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84
                       ++l+++l+G++ve+v++kn++++gikG Vv+Et+ntl+i++++ r  ++pK+ +vF f++ + ++v+vdG+ l+ rp++R ++
  SwissProt::Q57903  6 NILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGREVVIPKDIAVFLFQL-KGCKVKVDGRLLIGRPEERLKK 87
                       799*********************************************************.699****************986 PP



Or compare SwissProt::Q57903 to CDD or PaperBLAST