SwissProt::Q57903 has 95 amino acids
Query: RNase_P-MRP_p29 [M=84]
Accession: PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.2e-31 94.8 1.5 1.3e-31 94.7 1.5 1.0 1 SwissProt::Q57903
Domain annotation for each sequence (and alignments):
>> SwissProt::Q57903
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 94.7 1.5 1.3e-31 1.3e-31 2 84 .] 6 87 .. 5 87 .. 0.96
Alignments for each domain:
== domain 1 score: 94.7 bits; conditional E-value: 1.3e-31
RNase_P-MRP_p29 2 kllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84
++l+++l+G++ve+v++kn+ ++GikG vvdEt+ntl+i++++++ ++ipK+ +vF f+l+ kv+++G+ l++rpe+R+kk
SwissProt::Q57903 6 NILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGREVVIPKDIAVFLFQLKGC-KVKVDGRLLIGRPEERLKK 87
89**********************************************************444.9***************997 PP
Or compare SwissProt::Q57903 to CDD or PaperBLAST