PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8U007 to PF01868 (RNase_P-MRP_p29)

SwissProt::Q8U007 has 127 amino acids

Query:       RNase_P-MRP_p29  [M=84]
Accession:   PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.9e-32   96.1   0.4    8.6e-32   95.3   0.1    1.5  2  SwissProt::Q8U007  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8U007  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.9   0.0      0.18      0.18      67      81 ..      21      35 ..       9      37 .. 0.78
   2 !   95.3   0.1   8.6e-32   8.6e-32       1      84 []      41     123 ..      41     123 .. 0.98

  Alignments for each domain:
  == domain 1  score: -1.9 bits;  conditional E-value: 0.18
    RNase_P-MRP_p29 67 veikGsqlllrpedR 81
                        ei G+  ++r ++R
  SwissProt::Q8U007 21 QEIIGRTWIFRGAHR 35
                       578999999998888 PP

  == domain 2  score: 95.3 bits;  conditional E-value: 8.6e-32
    RNase_P-MRP_p29   1 akllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84 
                        ++++ ++l+G++v+Vv+s++p +vGi+G v+dEt+n+l+i+  enkv+++pK+ ++Fefe  +++k++i G++l++rpe R+kk
  SwissProt::Q8U007  41 KNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAG-ENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKK 123
                        589**************************************9.9********************9****************997 PP



Or compare SwissProt::Q8U007 to CDD or PaperBLAST