SwissProt::Q8U007 has 127 amino acids
Query: RNase_P-MRP_p29 [M=84] Accession: PF01868.20 Description: Ribonuclease P/MRP, subunit p29 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.9e-32 96.1 0.4 8.6e-32 95.3 0.1 1.5 2 SwissProt::Q8U007 Domain annotation for each sequence (and alignments): >> SwissProt::Q8U007 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.18 0.18 67 81 .. 21 35 .. 9 37 .. 0.78 2 ! 95.3 0.1 8.6e-32 8.6e-32 1 84 [] 41 123 .. 41 123 .. 0.98 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.18 RNase_P-MRP_p29 67 veikGsqlllrpedR 81 ei G+ ++r ++R SwissProt::Q8U007 21 QEIIGRTWIFRGAHR 35 578999999998888 PP == domain 2 score: 95.3 bits; conditional E-value: 8.6e-32 RNase_P-MRP_p29 1 akllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84 ++++ ++l+G++v+Vv+s++p +vGi+G v+dEt+n+l+i+ enkv+++pK+ ++Fefe +++k++i G++l++rpe R+kk SwissProt::Q8U007 41 KNIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAG-ENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKK 123 589**************************************9.9********************9****************997 PP
Or compare SwissProt::Q8U007 to CDD or PaperBLAST