PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8U007 to PF01868 (UPF0086)

SwissProt::Q8U007 has 127 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    6.4e-29   86.1   0.1    1.8e-28   84.6   0.0    1.7  2  SwissProt::Q8U007  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8U007  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.2   0.0      0.11      0.11      66      81 ..      20      35 ..      16      37 .. 0.84
   2 !   84.6   0.0   1.8e-28   1.8e-28       2      84 .]      42     123 ..      41     123 .. 0.97

  Alignments for each domain:
  == domain 1  score: -1.2 bits;  conditional E-value: 0.11
                       EEEEECCCCSSXHHHH CS
            UPF0086 66 evevdGsqlryrpadR 81
                       + e+ G+  ++r a+R
  SwissProt::Q8U007 20 YQEIIGRTWIFRGAHR 35
                       67999***99999998 PP

  == domain 2  score: 84.6 bits;  conditional E-value: 1.8e-28
                        HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
            UPF0086   2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84 
                        +++ ++l+G++v+Vv+s++p +vgi+G V++Et+n+l+i+  +++v  vpK+ ++Fefe  d ++++++G++l  rp+ R ++
  SwissProt::Q8U007  42 NIVWHELIGLKVRVVNSTHPGYVGIEGYVIDETRNMLVIAG-ENKVWKVPKDVCIFEFETWDGTKIKISGEKLVGRPEMRLKK 123
                        7999************************************9.9*****************9999****************986 PP



Or compare SwissProt::Q8U007 to CDD or PaperBLAST