PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS10091545 to PF01868 (UPF0086)

VIMSS10091545 has 296 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
      2e-23   68.5   0.0    4.9e-23   67.2   0.0    1.6  1  VIMSS10091545  


Domain annotation for each sequence (and alignments):
>> VIMSS10091545  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   67.2   0.0   4.9e-23   4.9e-23       2      77 ..     216     290 ..     215     292 .. 0.98

  Alignments for each domain:
  == domain 1  score: 67.2 bits;  conditional E-value: 4.9e-23
                    HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSX CS
        UPF0086   2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryr 77 
                    +Ll+adlhGa + V+++k +s +g++Gi+v+Et +t+ i+t++++ ++vpK+ svF +++ d+++++++G+++++r
  VIMSS10091545 216 TLLSADLHGAFMFVAECKIASFTGVQGIMVRETSETFGIITRDDKFRVVPKKLSVFIIQL-DCWKITLHGDKFISR 290
                    79**********************************************************.8***********998 PP



Or compare VIMSS10091545 to CDD or PaperBLAST