PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS20011 to PF01868 (UPF0086)

VIMSS20011 has 93 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.6e-26   78.4   0.3    1.8e-26   78.2   0.3    1.0  1  VIMSS20011  


Domain annotation for each sequence (and alignments):
>> VIMSS20011  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   78.2   0.3   1.8e-26   1.8e-26       2      84 .]       6      88 ..       5      88 .. 0.97

  Alignments for each domain:
  == domain 1  score: 78.2 bits;  conditional E-value: 1.8e-26
                HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
     UPF0086  2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84
                ++++++l+G+ v+++rs ++++ gi+G+Vv+Et+ntl+i+ ++ r  tvpK  +vF+f+  +   ve+dG+ l  rp++R+++
  VIMSS20011  6 NIFRHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGREITVPKGIAVFHFRTPQGELVEIDGRALVARPEERIKK 88
                789*********************************************************88889***************997 PP



Or compare VIMSS20011 to CDD or PaperBLAST