PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS23776 to PF01868 (UPF0086)

VIMSS23776 has 102 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    2.9e-27   80.8   0.2    3.3e-27   80.6   0.2    1.1  1  VIMSS23776  


Domain annotation for each sequence (and alignments):
>> VIMSS23776  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   80.6   0.2   3.3e-27   3.3e-27       2      84 .]       9      89 ..       8      89 .. 0.96

  Alignments for each domain:
  == domain 1  score: 80.6 bits;  conditional E-value: 3.3e-27
                HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
     UPF0086  2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84
                +L+  d++G+ veVv+s n s vgikG Vv+Et+ntlki+t ++++k+v K+g +F++ + +   ++++G+ +++rp+dR++r
  VIMSS23776  9 ELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMT-EKGLKVVAKRGRTFRVWY-KGKIMRIKGDLINFRPEDRIKR 89
                58999************************************.89****************.5888****************97 PP



Or compare VIMSS23776 to CDD or PaperBLAST