VIMSS23776 has 102 amino acids
Query: RNase_P-MRP_p29 [M=84] Accession: PF01868.20 Description: Ribonuclease P/MRP, subunit p29 Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.5e-30 89.3 0.3 7.5e-30 89.1 0.3 1.1 1 VIMSS23776 Domain annotation for each sequence (and alignments): >> VIMSS23776 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 89.1 0.3 7.5e-30 7.5e-30 2 84 .] 9 89 .. 8 89 .. 0.95 Alignments for each domain: == domain 1 score: 89.1 bits; conditional E-value: 7.5e-30 RNase_P-MRP_p29 2 kllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84 +l+ d++G++veVv+s n+s vGikG vvdEt+ntlki+t e+ +k++ K+g +F++ ++ + ++ikG+ +++rpedR+k+ VIMSS23776 9 ELIARDWIGLMVEVVESPNHSEVGIKGEVVDETQNTLKIMT-EKGLKVVAKRGRTFRVWYKGK-IMRIKGDLINFRPEDRIKR 89 58999************************************.899***************444.8****************96 PP
Or compare VIMSS23776 to CDD or PaperBLAST