PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS31556 to PF01868 (UPF0086)

VIMSS31556 has 127 amino acids

Query:       UPF0086  [M=84]
Accession:   PF01868.16
Description: Domain of unknown function UPF0086
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.8e-26   78.2   0.1    5.2e-26   76.7   0.0    1.7  2  VIMSS31556  


Domain annotation for each sequence (and alignments):
>> VIMSS31556  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.0   0.1     0.094     0.094      66      81 ..      20      35 ..      10      37 .. 0.84
   2 !   76.7   0.0   5.2e-26   5.2e-26       2      84 .]      42     122 ..      41     122 .. 0.97

  Alignments for each domain:
  == domain 1  score: -1.0 bits;  conditional E-value: 0.094
                EEEEECCCCSSXHHHH CS
     UPF0086 66 evevdGsqlryrpadR 81
                + e+ G+  ++r a+R
  VIMSS31556 20 YQEIIGRTWIFRGAHR 35
                6799999999999998 PP

  == domain 2  score: 76.7 bits;  conditional E-value: 5.2e-26
                 HHCCSXXSS-EEEEEECSSTTTTTEEEEEEEEETTEEEEEECTTEEEEEESTTCEEEEEE.TTEEEEEECCCCSSXHHHHHCH CS
     UPF0086   2 kLlkadlhGaeveVvrsknpslvgikGiVvkEtkntlkivtkksrvktvpKegsvFefevkdvlevevdGsqlryrpadRaer 84 
                 +++ ++l+G++v++v s++p+ vgi+G V++Et+n+l+i+   +r+  vpK+ ++Fefe +d +++++ G++l  rp+ R ++
  VIMSS31556  42 NIIWHELIGLRVRIVGSTHPAFVGIEGYVIDETRNMLVIAG--DRIWKVPKDVCIFEFEADDGTKIKIPGERLVGRPEMRLKK 122
                 7899***********************************97..89***********************************986 PP



Or compare VIMSS31556 to CDD or PaperBLAST