PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS9036 to PF01868 (RNase_P-MRP_p29)

VIMSS9036 has 95 amino acids

Query:       RNase_P-MRP_p29  [M=84]
Accession:   PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    1.2e-31   94.8   1.5    1.3e-31   94.7   1.5    1.0  1  VIMSS9036  


Domain annotation for each sequence (and alignments):
>> VIMSS9036  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   94.7   1.5   1.3e-31   1.3e-31       2      84 .]       6      87 ..       5      87 .. 0.96

  Alignments for each domain:
  == domain 1  score: 94.7 bits;  conditional E-value: 1.3e-31
  RNase_P-MRP_p29  2 kllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84
                     ++l+++l+G++ve+v++kn+ ++GikG vvdEt+ntl+i++++++ ++ipK+ +vF f+l+   kv+++G+ l++rpe+R+kk
        VIMSS9036  6 NILRHELIGLKVEIVEAKNKAMIGIKGKVVDETRNTLVIEKEDGREVVIPKDIAVFLFQLKGC-KVKVDGRLLIGRPEERLKK 87
                     89**********************************************************444.9***************997 PP



Or compare VIMSS9036 to CDD or PaperBLAST