PaperBLAST – Find papers about a protein or its homologs

 

Align XP_966262.2 to PF01868 (RNase_P-MRP_p29)

XP_966262.2 has 291 amino acids

Query:       RNase_P-MRP_p29  [M=84]
Accession:   PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    4.1e-22   64.3   0.0    6.4e-22   63.6   0.0    1.3  1  XP_966262.2  


Domain annotation for each sequence (and alignments):
>> XP_966262.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   63.6   0.0   6.4e-22   6.4e-22       6      82 ..     204     279 ..     199     281 .. 0.92

  Alignments for each domain:
  == domain 1  score: 63.6 bits;  conditional E-value: 6.4e-22
  RNase_P-MRP_p29   6 adlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRa 82 
                       +l+Ga +eV++s++ +++G +Gi++ Et n++kivt+ nkv ++ K+++vF ++++e+ ++ ++G qll  p+ ++
      XP_966262.2 204 IELNGAYIEVHKSRCSTYIGQRGIIILETHNSFKIVTPTNKVLILLKNKTVFILTIKER-QYYLHGIQLLRDPALKS 279
                      69******************************************************555.9********99888665 PP



Or compare XP_966262.2 to CDD or PaperBLAST