biolip::6ahrD has 145 amino acids
Query: RNase_P-MRP_p29 [M=84]
Accession: PF01868.20
Description: Ribonuclease P/MRP, subunit p29
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.4e-33 98.5 0.1 1.1e-32 98.2 0.1 1.1 1 biolip::6ahrD
Domain annotation for each sequence (and alignments):
>> biolip::6ahrD
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 98.2 0.1 1.1e-32 1.1e-32 1 84 [] 53 135 .. 53 135 .. 0.95
Alignments for each domain:
== domain 1 score: 98.2 bits; conditional E-value: 1.1e-32
RNase_P-MRP_p29 1 akllkadlhGaeveVvrsknpslvGikGivvdEtkntlkivtkenkvktipKegsvFefelpeeekveikGsqlllrpedRakk 84
akllkadlhGa ++V++sk+ps+vGi+Gi ++Etk+ +ki+tke+++k+ipK ++vF++e + i+Gs+++lr+++R+ k
biolip::6ahrD 53 AKLLKADLHGAIISVTKSKCPSYVGITGILLQETKHIFKIITKEDRLKVIPKLNCVFTVETDGF-ISYIYGSKFQLRSSERSAK 135
59***********************************************************444.799*************976 PP
Or compare biolip::6ahrD to CDD or PaperBLAST