PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::D4GQN9 to PF01930 (Cas_Cas4)

SwissProt::D4GQN9 has 183 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    9.5e-47  145.3   0.0    1.1e-46  145.1   0.0    1.0  1  SwissProt::D4GQN9  


Domain annotation for each sequence (and alignments):
>> SwissProt::D4GQN9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  145.1   0.0   1.1e-46   1.1e-46       1     161 [.      26     182 ..      26     183 .] 0.98

  Alignments for each domain:
  == domain 1  score: 145.1 bits;  conditional E-value: 1.1e-46
           Cas_Cas4   1 tgtkiqyyliCkrklwlisheitleensetvelGkllheesyerekkevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlll 92 
                        tg ++qyy++Ckr+lw+++++i ++++ ++++ G  ++e+sy  +++++ ++++i++D+++       v+EvK s++ e+ a++Qll+Yl++
  SwissProt::D4GQN9  26 TGLMVQYYHVCKRELWFMANGIDIDRETTNIQRGTHVDETSYGTSRRSFMIDNRIQLDILD----SGDVMEVKVSSALEKPARMQLLFYLWY 113
                        689**********************************************************....8889*********************** PP

           Cas_Cas4  93 Le.kkgveikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                        L+  ++++++ Gvl yp+e+kre+v l+e+ + e+e++++ + +++ +++pp+ +kk++C +C y++lC+
  SwissProt::D4GQN9 114 LReIHDIDKD-GVLAYPTERKRESVVLDETTTAEVESTVRGVLDVVGRDSPPQLEKKPYCGTCLYQDLCW 182
                        **899***99.**********************************************************9 PP



Or compare SwissProt::D4GQN9 to CDD or PaperBLAST