PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS182047 to PF01930 (Cas_Cas4)

VIMSS182047 has 171 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      6e-21   61.4   0.0    7.5e-21   61.1   0.0    1.0  1  VIMSS182047  


Domain annotation for each sequence (and alignments):
>> VIMSS182047  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   61.1   0.0   7.5e-21   7.5e-21       7     161 ..      12     169 ..       8     170 .. 0.84

  Alignments for each domain:
  == domain 1  score: 61.1 bits;  conditional E-value: 7.5e-21
     Cas_Cas4   7 yyliCkrklwlisheitleensetvelGkllhe.......esyerek.....kevelse...sikiDvvekekeklvvvEvKkskkkeeaaklQllyY 89 
                   +  C+r lwl +++  +     ++ +G+  +        +           k v ++    ++++D++  ++  + +vE+K + + ++++k+Ql + 
  VIMSS182047  12 ELEWCPRYLWLSKRHGVPMTP--NMAAGRGAEAglrrflaK-----AlgaepKPVYIDAgwaHGVVDILV-KRVAASPVEIKTGLP-RREHKWQLYAE 100
                  6779*********97777666..466688887766554322.....233446*****55799*******9.889999*******99.789******** PP

     Cas_Cas4  90 lllLekkgveikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                  ++l+++ g  + +G++ y +  k  ++++++++ +++e+ + ++ e+i+   pp+++k  +C  C y+ +C 
  VIMSS182047 101 AYLVKAAGCAVYTGYITYGE--KIYRLQISKAELKAAETLLVKAAEVIEG-PPPPPVKTGKCAYCQYRAICT 169
                  ******************98..567788999******************9.788889999***********7 PP



Or compare VIMSS182047 to CDD or PaperBLAST