PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS193910 to PF01930 (Cas_Cas4)

VIMSS193910 has 919 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.9e-15   43.5   6.1    1.9e-15   43.5   6.1    3.1  3  VIMSS193910  


Domain annotation for each sequence (and alignments):
>> VIMSS193910  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.3   0.4      0.48      0.48      93     124 ..      41      72 ..      38      84 .. 0.64
   2 ?    1.3   0.1     0.019     0.019       3      44 ..     689     730 ..     687     755 .. 0.70
   3 !   43.5   6.1   1.9e-15   1.9e-15      46     161 ..     789     916 ..     756     917 .. 0.77

  Alignments for each domain:
  == domain 1  score: -3.3 bits;  conditional E-value: 0.48
     Cas_Cas4  93 LekkgveikeGvleypkekkreevelteelre 124
                  L +k ve+k+ ++   ++k  +e+el  ++r 
  VIMSS193910  41 LINKEVEAKKIMITTFTNKAAKELELRINERL 72 
                  55677888888888888888888777544432 PP

  == domain 2  score: 1.3 bits;  conditional E-value: 0.019
     Cas_Cas4   3 tkiqyyliCkrklwlisheitleensetvelGkllheesyer 44 
                  t+i  y +C+ k +l+  +     +++  +lG + h+  ++ 
  VIMSS193910 689 TDIALYRYCPMKYFLVREKEYSTFDKKVFNLGIITHKAIEHI 730
                  78999**********999777777778889999999833332 PP

  == domain 3  score: 43.5 bits;  conditional E-value: 1.9e-15
     Cas_Cas4  46 k..kevel.se...sikiDvvekekeklvvvEvKkskkk....eeaaklQllyYlllLe.kkgveikeGvleypkekkree.vel.teelreelekai 130
                      e+++ ++    ++iD++ ++++++ ++++K +k      + + + Ql  Y llL+ k + eik  +l+y++e + ++ + + +e+l+e le++ 
  VIMSS193910 789 VeaSEFRVeDNyilYGQIDLILEDENEIKIIDFKTGKYNefefSSNYRQQLSLYKLLLQkKYDKEIK-TYLYYLEEDEPKKeILIdDEDLKEDLENIN 885
                  1224555533377779********************97755556777************88999999.******9987555366625567889***** PP

     Cas_Cas4 131 keieeiissekppkvkkkkiCkkCayaelCl 161
                  k +++i++++ p  + +++iC  C+++++C+
  VIMSS193910 886 KTVQDILDKKFPKIPYNQNICGICEFKNYCW 916
                  ******************************9 PP



Or compare VIMSS193910 to CDD or PaperBLAST