PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS21068 to PF01930 (Cas_Cas4)

VIMSS21068 has 175 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    6.9e-62  194.5   0.2    7.7e-62  194.3   0.2    1.0  1  VIMSS21068  


Domain annotation for each sequence (and alignments):
>> VIMSS21068  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  194.3   0.2   7.7e-62   7.7e-62       2     162 .]      16     175 .]      15     175 .] 0.99

  Alignments for each domain:
  == domain 1  score: 194.3 bits;  conditional E-value: 7.7e-62
    Cas_Cas4   2 gtkiqyyliCkrklwlisheitleensetvelGkllheesyerekkevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLe.kkgve 99 
                 g +i+yy+iCk+klw++sh+i++e++se v+lGkllheesy+rekke+ +++ i+ D+v+ +k+ l+v+EvKk+  +eea+++QllyYl++L+ +kg+e
  VIMSS21068  16 GLQINYYFICKTKLWFFSHHISMERESELVKLGKLLHEESYTREKKELIIDDLIAADFVK-RKGYLEVHEVKKGMTMEEAHRFQLLYYLFYLKnEKGIE 113
                 889*********************************************************.************************************** PP

    Cas_Cas4 100 ikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCli 162
                 + +G+++yp  kkr+ev+l++e++eel+++i+ei++ii    pp +++k+iC++Cay+elC++
  VIMSS21068 114 KIRGFIDYPALKKRTEVSLSAEDEEELRRVIHEIDRIIMG-PPPAPQRKPICRSCAYFELCWA 175
                 **************************************99.8********************5 PP



Or compare VIMSS21068 to CDD or PaperBLAST