PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS240326 to PF01930 (Cas_Cas4)

VIMSS240326 has 170 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.8e-57  180.1   1.2      2e-57  180.0   1.2    1.0  1  VIMSS240326  


Domain annotation for each sequence (and alignments):
>> VIMSS240326  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  180.0   1.2     2e-57     2e-57       2     162 .]      12     170 .]      11     170 .] 0.99

  Alignments for each domain:
  == domain 1  score: 180.0 bits;  conditional E-value: 2e-57
     Cas_Cas4   2 gtkiqyyliCkrklwlisheitleensetvelGkllheesyerekkevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLekkgve 99 
                  g+ ++ y+iC+rk+wl+s++i ++e+   ++lG+l++e+sy+rekke++l e+++iD+v+ke+e+lv+ EvKks++ +eaa++Ql +Yl+ L+++ +e
  VIMSS240326  12 GSIVNAYIICPRKAWLMSRQIFPDEDYVYLHLGRLIQEQSYSREKKEIHL-EHLRIDLVRKEGETLVIAEVKKSSRGKEAARMQLAFYLYELKTMSIE 108
                  7889**********************************************.*********************************************** PP

     Cas_Cas4 100 ikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCli 162
                  +k G+l +p+e++ree+ l+e+ ++++e++ ++ie++i++e pp++k++++C+kCay e+C++
  VIMSS240326 109 AK-GELLFPEERRREEMILDEKWMKKIEETKEKIENLIQHELPPPPKYSSYCNKCAYGEFCWA 170
                  **.***********************************************************5 PP



Or compare VIMSS240326 to CDD or PaperBLAST