PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3375468 to PF01930 (Cas_Cas4)

VIMSS3375468 has 172 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.9e-57  179.5  11.4    3.2e-57  179.3  11.4    1.0  1  VIMSS3375468  


Domain annotation for each sequence (and alignments):
>> VIMSS3375468  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  179.3  11.4   3.2e-57   3.2e-57       1     161 [.      11     168 ..      11     169 .. 0.98

  Alignments for each domain:
  == domain 1  score: 179.3 bits;  conditional E-value: 3.2e-57
      Cas_Cas4   1 tgtkiqyyliCkrklwlisheitleensetvelGkllheesyer.ekkevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLe.k 95 
                   +g+ki+yy++Ckrklwl+s++it+e+ns++v  Gk++he+sy+r ++ke+ +++ +k+D+++    + +v EvK s+k++ea+++Ql yYl++L+ +
  VIMSS3375468  11 QGVKINYYYVCKRKLWLFSKGITMEQNSSRVLSGKIVHEDSYKRmKNKEILIDDILKLDIIK----DEYVKEVKISSKMKEADEMQLYYYLYYLKnS 103
                   599*****************************************666***************....9****************************** PP

      Cas_Cas4  96 kgveikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                   +g+e+k G ++y+kekk+ee+ ltee+++ +e+++ +i+ei  + +ppk +kk++C+kCay+e+C+
  VIMSS3375468 104 MGIEKK-GTINYVKEKKQEELILTEEKERIIENTLININEINMQLSPPKIEKKHYCTKCAYYEFCF 168
                   ******.**********************************************************9 PP



Or compare VIMSS3375468 to CDD or PaperBLAST