PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS544030 to PF01930 (Cas_Cas4)

VIMSS544030 has 168 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      6e-56  175.2   5.4    6.7e-56  175.0   5.4    1.0  1  VIMSS544030  


Domain annotation for each sequence (and alignments):
>> VIMSS544030  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  175.0   5.4   6.7e-56   6.7e-56       2     161 ..       6     165 ..       5     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 175.0 bits;  conditional E-value: 6.7e-56
     Cas_Cas4   2 gtkiqyyliCkrklwlisheitleensetvelGkllheesyerek..kevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLekkg 97 
                  g  i+yy++Ckrklw+++++it+e++s+ v++Gk+++  ++e++k  ++v + ++i+ Dv++++k+++ v+E+Kks+k++eaa +Ql+yYl++L++ g
  VIMSS544030   6 GAYIYYYFVCKRKLWFYANKITMEHESDLVQIGKYIELFYKEKHKyeRKVII-NEISPDVIKRYKDFVLVFEIKKSDKFKEAALWQLKYYLWYLKRLG 102
                  678**********************************988888777899***.********************************************* PP

     Cas_Cas4  98 veikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                  +++k G+l +p+ +k+e +elte+++++++++++ei++iis++kpp+ + k +Ck+Cay++lC+
  VIMSS544030 103 LNVK-GKLVIPEYNKEEYIELTEKDERKIKEILNEIKRIISMDKPPREVFKDYCKACAYYPLCW 165
                  ****.**********************************************************9 PP



Or compare VIMSS544030 to CDD or PaperBLAST