PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS563203 to PF01930 (Cas_Cas4)

VIMSS563203 has 170 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.4e-57  178.6   0.5    6.1e-57  178.4   0.5    1.0  1  VIMSS563203  


Domain annotation for each sequence (and alignments):
>> VIMSS563203  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  178.4   0.5   6.1e-57   6.1e-57       2     161 ..       6     165 ..       5     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 178.4 bits;  conditional E-value: 6.1e-57
     Cas_Cas4   2 gtkiqyyliCkrklwlisheitleensetvelGkllheesyer..ek.kevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLekk 96 
                  gt+ +y+ +C+rklwl+s +it+e+ s+ v++Gkl+he++y++  e+ +e+el + ikiD+ +  +++ vv+EvKks+k+++a++lQllyYl++Le++
  VIMSS563203   6 GTHFNYHQVCRRKLWLFSAGITMEHTSDLVYEGKLIHETTYQQrpERyQELEL-DGIKIDFYD--AKNRVVHEVKKSNKISPAHRLQLLYYLYVLERN 100
                  899**************************************99554489****.*********..999****************************** PP

     Cas_Cas4  97 gveikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                  gv   +G+leyp+ +k+eev l++ +re+++++ +ei +iis+e +p+v ++ iCk+C+y+e+C+
  VIMSS563203 101 GVLGATGILEYPTLRKKEEVILSDIDRERIREIEQEILQIISHEDCPPVIDSGICKNCSYYEFCF 165
                  ****************************************************************9 PP



Or compare VIMSS563203 to CDD or PaperBLAST