PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7321367 to PF01930 (Cas_Cas4)

VIMSS7321367 has 180 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      2e-22   66.2   0.0    2.5e-22   65.9   0.0    1.0  1  VIMSS7321367  


Domain annotation for each sequence (and alignments):
>> VIMSS7321367  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.9   0.0   2.5e-22   2.5e-22       7     160 ..      16     172 ..      12     174 .. 0.87

  Alignments for each domain:
  == domain 1  score: 65.9 bits;  conditional E-value: 2.5e-22
      Cas_Cas4   7 yyliCkrklwlisheitleensetvelGkllheesyerek.......kevelse...sikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllL 93 
                    +  C+r lwl +++  +     ++  G++ ++   ++         k v ++    ++++D+v  +++ +v+vE+K + + ++++k+Ql + ++l+
  VIMSS7321367  16 ELEWCPRYLWLSKRHGVPTTP--SMAKGRQEEQALRKKLAaalgaepKPVYIDAgwtHGVVDMVA-RRHSAVPVEIKTGVP-RREHKWQLYAEAYLV 108
                   6779**********9999998..5666**999844444223455667*****54799********.9999*********99.789************ PP

      Cas_Cas4  94 ekkgveikeGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelC 160
                   +++g +++ Gv+ y +  +  ++++t+++ + +e  + ++ e+++   pp++ k ++C  C y+++C
  VIMSS7321367 109 KAQGHSVSLGVIAYGE--RLARLQITPAELKVAEALLIKAAEVVEG-PPPPPRKTPKCAYCQYRPIC 172
                   **************97..5778999*******************99.799999************** PP



Or compare VIMSS7321367 to CDD or PaperBLAST