PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS819168 to PF01930 (Cas_Cas4)

VIMSS819168 has 75 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.8e-10   26.7   0.0    3.5e-10   26.4   0.0    1.1  1  VIMSS819168  


Domain annotation for each sequence (and alignments):
>> VIMSS819168  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   26.4   0.0   3.5e-10   3.5e-10     123     161 ..      17      55 ..      14      56 .. 0.94

  Alignments for each domain:
  == domain 1  score: 26.4 bits;  conditional E-value: 3.5e-10
     Cas_Cas4 123 reelekaikeieeiissekppkvkkkkiCkkCayaelCl 161
                  r ++  +i+ ++e+++s ++p++ + k+Ck+C++ e+C 
  VIMSS819168  17 RAQTLATIAAVRELLNSGQTPPPDYGKRCKACSLVEICQ 55 
                  788999********************************7 PP



Or compare VIMSS819168 to CDD or PaperBLAST