PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS8948 to PF01930 (Cas_Cas4)

VIMSS8948 has 170 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------  -----------
    5.8e-59  185.0   7.3    6.6e-59  184.8   7.3    1.0  1  VIMSS8948  


Domain annotation for each sequence (and alignments):
>> VIMSS8948  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  184.8   7.3   6.6e-59   6.6e-59       2     162 .]      13     170 .]      12     170 .] 0.99

  Alignments for each domain:
  == domain 1  score: 184.8 bits;  conditional E-value: 6.6e-59
   Cas_Cas4   2 gtkiqyyliCkrklwlisheitleensetvelGkllheesyerekkevelsesikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLekkgveik 101
                g++i+y+++Ck+klw++ ++it+e++s+ v+lGk+lhe+sy  e+kev++ +sikiD+++ +++ ++++EvK++k++e+a+ +Q+lyY+++L++ g++ k
  VIMSS8948  13 GIEINYLYVCKTKLWYFVRGITMEQESDFVDLGKFLHEKSYFGEEKEVQI-GSIKIDFIK-KRDVIEIHEVKRGKQMEKAHIMQVLYYIYYLNSLGIKSK 110
                899***********************************************.*********.999************************************ PP

   Cas_Cas4 102 eGvleypkekkreevelteelreelekaikeieeiissekppkvkkkkiCkkCayaelCli 162
                 ++l+ypk k+ +e+el+e+++ee+++aikeie i s ++pp++ ++kiCk+Cay+elC+i
  VIMSS8948 111 -AILHYPKLKEIKEIELKENNKEEIKRAIKEIEYIKSLKEPPEPIYQKICKNCAYYELCFI 170
                .**********************************************************96 PP



Or compare VIMSS8948 to CDD or PaperBLAST