PaperBLAST – Find papers about a protein or its homologs

 

Align YP_006250236.1 to PF01930 (Cas_Cas4)

YP_006250236.1 has 245 amino acids

Query:       Cas_Cas4  [M=162]
Accession:   PF01930.17
Description: Domain of unknown function DUF83
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.4e-10   26.1   0.0    6.8e-10   25.4   0.0    1.2  1  YP_006250236.1  


Domain annotation for each sequence (and alignments):
>> YP_006250236.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   25.4   0.0   6.8e-10   6.8e-10      54     106 ..     157     209 ..     143     227 .. 0.88

  Alignments for each domain:
  == domain 1  score: 25.4 bits;  conditional E-value: 6.8e-10
        Cas_Cas4  54 sikiDvvekekeklvvvEvKkskkkeeaaklQllyYlllLekkgveikeGvle 106
                      +++D+v + ++++vvv++K s +  +++ lQ+ +Y+l L+++g+e++ G++ 
  YP_006250236.1 157 AGRVDLVARLGGRVVVVDLKTSPRVYPEHLLQVGAYALALREEGLEVEGGFVV 209
                     799*********************************************88765 PP



Or compare YP_006250236.1 to CDD or PaperBLAST