PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS18415 to PF01931 (NTPase_I-T)

VIMSS18415 has 170 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    9.7e-57  177.5   0.0    1.1e-56  177.3   0.0    1.0  1  VIMSS18415  


Domain annotation for each sequence (and alignments):
>> VIMSS18415  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.3   0.0   1.1e-56   1.1e-56       1     162 [.       7     165 ..       7     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 177.3 bits;  conditional E-value: 1.1e-56
                 S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEEEE CS
  NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsvgr 97 
                 +++Np+K++A+ +af+++f +  +++ +v+v+sgv++qP+g+eet++GA+nR++na++  +ead++v++E+G++       +++w+++ ++ ++++ +r
  VIMSS18415   7 ATTNPAKIQAILQAFHEIFGEgsCHIASVAVESGVPEQPFGSEETRAGARNRVANARRLLPEADFWVAIEAGIDG----DSTFSWVVIENA-SQRGEAR 100
                 69******************9899999**********************************************66....789****88888.799**** PP

                 ---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHH CS
  NTPase_I-T  98 sasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipf 162
                 sa+++lP  ++e+v+ege lg+vm++++g ++i++keGaig++T g++tR+++y+qavilAl pf
  VIMSS18415 101 SATLPLPAVILEKVREGEALGPVMSRYTGIDEIGRKEGAIGVFTAGKLTRASVYHQAVILALSPF 165
                 ****************************************************************9 PP



Or compare VIMSS18415 to CDD or PaperBLAST