PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS267417 to PF01931 (NTPase_I-T)

VIMSS267417 has 169 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-49  154.7   0.0    1.2e-49  154.4   0.0    1.0  1  VIMSS267417  


Domain annotation for each sequence (and alignments):
>> VIMSS267417  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  154.4   0.0   1.2e-49   1.2e-49       1     156 [.       6     156 ..       6     162 .. 0.96

  Alignments for each domain:
  == domain 1  score: 154.4 bits;  conditional E-value: 1.2e-49
                  S---HHHHHHHHHHHHHHCTTEEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEEEE- CS
   NTPase_I-T   1 gSkNpvKveAvkeafeklfkdvevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsvgrs 98 
                  gSkN++Kv Av+++ +    d+e++++svpsgv++qP++deet++GAinRak+ale+ + a++g+GlEgGv ++e++l+ ++w a ++++g++ v+ +
  VIMSS267417   6 GSKNKTKVGAVEKVWK----DAEITSLSVPSGVAAQPFSDEETMQGAINRAKRALEEGD-AQIGIGLEGGVMKTEHGLFMCNWGALATSDGKIFVAGG 98 
                  8*********998766....779**********************************66.************************************** PP

                  --EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHH CS
   NTPase_I-T  99 asfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavi 156
                  a+++lP++++  ++eg+el+evm+e++++++i+++eGaig++T++ v+R++l+ + v 
  VIMSS267417  99 ARITLPDDFLAPLEEGKELSEVMEEFVQRKDIRSHEGAIGIFTDDYVDRTELFVHVVK 156
                  ****************************************************999876 PP



Or compare VIMSS267417 to CDD or PaperBLAST