PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS53307 to PF01931 (NTPase_I-T)

VIMSS53307 has 183 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence   Description
    ------- ------ -----    ------- ------ -----   ---- --  --------   -----------
    1.5e-63  199.7   0.0    1.7e-63  199.5   0.0    1.0  1  VIMSS53307  


Domain annotation for each sequence (and alignments):
>> VIMSS53307  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  199.5   0.0   1.7e-63   1.7e-63       1     163 []      16     175 ..      16     175 .. 0.96

  Alignments for each domain:
  == domain 1  score: 199.5 bits;  conditional E-value: 1.7e-63
                 S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEEEE CS
  NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsvgr 97 
                 +S+Np+Kv+Av++af+++f+d  +e+ gvsvps+v+dqPm+deet +GA+nR++na+++++ a+y+vGlE+G+ee      ++aw++v +  ++++ +r
  VIMSS53307  16 ASQNPAKVNAVRSAFSTVFPDqeWEFIGVSVPSEVADQPMSDEETKQGALNRVRNAKQRHPGAEYYVGLEAGIEE----NKTFAWMIVESD-QQRGESR 109
                 79******************98899************************************************98....679****66655.899**** PP

                 ---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHHH CS
  NTPase_I-T  98 sasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipfl 163
                 sa ++lP+ v+e++++ +elg+vmde+fgtenikqk+GaigllT++++tR+++y+qa+ilAlipf+
  VIMSS53307 110 SACLMLPPLVLERLRQAKELGDVMDEVFGTENIKQKGGAIGLLTRHHLTRSTVYHQALILALIPFI 175
                 ****************************************************************96 PP



Or compare VIMSS53307 to CDD or PaperBLAST