PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5785852 to PF01931 (NTPase_I-T)

VIMSS5785852 has 179 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    9.3e-57  177.5   0.0    1.1e-56  177.3   0.0    1.0  1  VIMSS5785852  


Domain annotation for each sequence (and alignments):
>> VIMSS5785852  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  177.3   0.0   1.1e-56   1.1e-56       1     162 [.       7     165 ..       7     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 177.3 bits;  conditional E-value: 1.1e-56
                   S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEE CS
    NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsv 95 
                   +++Np+K++A+k afe++f +  +++e ++v+s v++qP+g+ et++GA++R+ +a++  +ead++vG+E+G+e+     +++aw+++ ++ + ++ 
  VIMSS5785852   7 ATTNPAKINAIKLAFEQVFGKdtFDIEDINVDSRVPQQPIGNTETRTGARQRVMAARQVRPEADFWVGVEAGIED----DMTFAWIVIEHE-QIRGE 98 
                   69******************889**************************************************88....89*****88777.799** PP

                   EE---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHH CS
    NTPase_I-T  96 grsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipf 162
                   +rsas++lPe++++ v+eg+elg+ m  l++ +nikqk+Gaig++T+gl++R+++y+qa++lAl+p+
  VIMSS5785852  99 SRSASLMLPEQILKGVREGRELGDEMAFLTKIDNIKQKGGAIGYFTDGLLSRTSVYQQAIVLALVPV 165
                   *****************************************************************97 PP



Or compare VIMSS5785852 to CDD or PaperBLAST