PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS5803490 to PF01931 (NTPase_I-T)

VIMSS5803490 has 171 amino acids

Query:       NTPase_I-T  [M=163]
Accession:   PF01931.18
Description: Protein of unknown function DUF84
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.4e-56  177.0   0.0    1.6e-56  176.8   0.0    1.0  1  VIMSS5803490  


Domain annotation for each sequence (and alignments):
>> VIMSS5803490  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  176.8   0.0   1.6e-56   1.6e-56       1     162 [.       7     165 ..       7     166 .. 0.97

  Alignments for each domain:
  == domain 1  score: 176.8 bits;  conditional E-value: 1.6e-56
                   S---HHHHHHHHHHHHHHCTT..EEEEEEE---SS-SS-BSHHHHHHHHHHHHHHHHHHSTTSSEEEEEEEEEET....TEEEEEE.EEEESS-EEE CS
    NTPase_I-T   1 gSkNpvKveAvkeafeklfkd..vevegvsvpsgvsdqPmgdeetlkGAinRaknaleaaeeadygvGlEgGveeleeklldvawaavvdkegrvsv 95 
                   +++Np+K++A+ +afe++f +  +++++v+v+sgv++qP+g+eet++GA+nR+ na++ +++ad++v++E+G+++     ++++w+++ ++  +++ 
  VIMSS5803490   7 ATTNPAKIQAILQAFEEIFGEgsCHITPVAVESGVPEQPFGSEETRAGARNRVDNARRLHPQADFWVAIEAGIDD----DATFSWVVIDNG-VQRGE 98 
                   69******************99999************************************************88....789****88877.799** PP

                   EE---EE--HHHHHHHCTT--HHHHHHHHHTHCCHHHTTHHHHHHTTTSS-HHHHHHHHHHHHTHHH CS
    NTPase_I-T  96 grsasfelPeevveevkegeelgevmdelfgtenikqkeGaigllTkglvtRedlyeqavilAlipf 162
                   +rsa+++lP  ++++v++ge lg+vm+ ++g ++i++keGaig++T g++tR+++y qavilAl pf
  VIMSS5803490  99 ARSATLPLPAVILDRVRQGEALGPVMSHYTGIDEIGRKEGAIGVFTAGKLTRSSVYYQAVILALSPF 165
                   ******************************************************************9 PP



Or compare VIMSS5803490 to CDD or PaperBLAST